Lipid phosphate phosphohydrolase 2 (PPAP2C) Recombinant Protein | PPAP2C recombinant protein

Recombinant Human Lipid phosphate phosphohydrolase 2 (PPAP2C)

• Gene Names: PPAP2C; LPP2; PAP-2c; PAP2-g
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Lipid phosphate phosphohydrolase 2 (PPAP2C); Recombinant Human Lipid phosphate phosphohydrolase 2 (PPAP2C); Recombinant Lipid phosphate phosphohydrolase 2 (PPAP2C); Lipid phosphate phosphohydrolase 2 EC= 3.1.3.4; PAP2-gamma; PAP2-G Phosphatidate phosphohydrolase type 2c Phosphatidic acid phosphatase 2c; PAP-2c; PAP2c; PPAP2C recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-288
• Sequence: MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS
• Sequence Length: 288

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 4505977
• NCBI GeneID: 8612
• NCBI Accession #: NP_003703.1
• NCBI GenBank Nucleotide #: NM_003712.2
• UniProt Accession #: O43688; A6NLV0
• Molecular Weight: 32,574 Da
• NCBI Official Full Name: lipid phosphate phosphohydrolase 2 isoform 1
• NCBI Official Synonym Full Names: phosphatidic acid phosphatase type 2C
• NCBI Official Symbol: PPAP2C
• NCBI Official Synonym Symbols: LPP2; PAP-2c; PAP2-g
• NCBI Protein Information: lipid phosphate phosphohydrolase 2; PAP2c; PAP2-gamma; phosphatidic acid phosphatase 2c; phosphatidate phosphohydrolase type 2c; phosphatidic acid phosphohydrolase type 2c; type-2 phosphatidic acid phosphatase-gamma
• UniProt Protein Name: Lipid phosphate phosphohydrolase 2
• UniProt Gene Name: PPAP2C
• UniProt Synonym Gene Names: LPP2; PAP2-G; PAP-2c; PAP2c
• UniProt Entry Name: LPP2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is similar to phosphatidic acid phosphatase type 2A (PPAP2A) and type 2B (PPAP2B). All three proteins contain 6 transmembrane regions, and a consensus N-glycosylation site. This protein has been shown to possess membrane associated PAP activity. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

PPAP2C: Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1- phosphate (S-1-P). The relative catalytic efficiency is PA > C-1-P > LPA > S-1-P. Belongs to the PA-phosphatase related phosphoesterase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Lipid Metabolism - ether lipid; Lipid Metabolism - sphingolipid; Lipid Metabolism - glycerophospholipid; Membrane protein, integral; Lipid Metabolism - glycerolipid; Membrane protein, multi-pass; EC 3.1.3.4; Phosphatase, lipid

Chromosomal Location of Human Ortholog: 19p13

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: phosphatidate phosphatase activity; phosphoprotein phosphatase activity

Biological Process: sphingolipid metabolic process; sphingolipid biosynthetic process; dephosphorylation