Adenylate cyclase type 6 (ADCY6) Recombinant Protein | ADCY6 recombinant protein

Recombinant Human Adenylate cyclase type 6 (ADCY6), partial

Cat. Num. AAA1151692

• Gene Names: ADCY6; AC6; LCCS8
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Adenylate cyclase type 6 (ADCY6); Recombinant Human Adenylate cyclase type 6 (ADCY6); partial; ADCY6 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 760-819
• Sequence: NMFTCNHTPIRSCAARMLNLTPADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGN
• Sequence Length: 1168

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 10181096
• NCBI GeneID: 112
• NCBI Accession #: NP_056085.1
• NCBI GenBank Nucleotide #: NM_015270.4
• UniProt Accession #: O43306; Q9NR75; Q9UDB0
• Molecular Weight: 124,865 Da
• NCBI Official Full Name: adenylate cyclase type 6
• NCBI Official Synonym Full Names: adenylate cyclase 6
• NCBI Official Symbol: ADCY6
• NCBI Official Synonym Symbols: AC6; LCCS8
• NCBI Protein Information: adenylate cyclase type 6
• UniProt Protein Name: Adenylate cyclase type 6
• Protein Family: Adenylate cyclase
• UniProt Gene Name: ADCY6
• UniProt Synonym Gene Names: KIAA0422

NCBI Description

This gene encodes a member of the adenylyl cyclase family of proteins, which are required for the synthesis of cyclic AMP. All members of this family have an intracellular N-terminus, a tandem repeat of six transmembrane domains separated by a cytoplasmic loop, and a C-terminal cytoplasmic domain. The two cytoplasmic regions bind ATP and form the catalytic core of the protein. Adenylyl cyclases are important effectors of transmembrane signaling pathways and are regulated by the activity of G protein coupled receptor signaling. This protein belongs to a small subclass of adenylyl cyclase proteins that are functionally related and are inhibited by protein kinase A, calcium ions and nitric oxide. A mutation in this gene is associated with arthrogryposis multiplex congenita. [provided by RefSeq, May 2015]

Uniprot Description

Catalyzes the formation of the signaling molecule cAMP downstream of G protein-coupled receptors (PubMed:17916776, PubMed:17110384). Functions in signaling cascades downstream of beta-adrenergic receptors in the heart and in vascular smooth muscle cells (PubMed:17916776). Functions in signaling cascades downstream of the vasopressin receptor in the kidney and has a role in renal water reabsorption. Functions in signaling cascades downstream of PTH1R and plays a role in regulating renal phosphate excretion. Functions in signaling cascades downstream of the VIP and SCT receptors in pancreas and contributes to the regulation of pancreatic amylase and fluid secretion (). Signaling mediates cAMP-dependent activation of protein kinase PKA. This promotes increased phosphorylation of various proteins, including AKT. Plays a role in regulating cardiac sarcoplasmic reticulum Ca2+ uptake and storage, and is required for normal heart ventricular contractibility. May contribute to normal heart function (). Mediates vasodilatation after activation of beta-adrenergic receptors by isoproterenol (PubMed:17916776). Contributes to bone cell responses to mechanical stimuli ().