Protein ROT1 (ROT1) Recombinant Protein | PGUG_04699 recombinant protein
Recombinant Meyerozyma guilliermondii Protein ROT1 (ROT1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein ROT1 (ROT1); Recombinant Meyerozyma guilliermondii Protein ROT1 (ROT1); Recombinant Protein ROT1 (ROT1); Protein ROT1; PGUG_04699 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-241
Sequence
DPNMKELAGTWTSKSNTVFTGPGFYDPVDELLIQPDLPGISYSFTEDGHYEEALYRVTSNSQNHSCATAVLIYQHGTYEILNNGSLVMTPIAVDGRQLLSDPCGYSETESQYTRYVQPTWFKAYYVQVDSYSGKMKLQIYQFDGSLMQPLYLAYSPPLMLPTKALNPTDKASETKSSLRRKVKRSLENQYRTTAVKSFNYEKYDKYWWAAVGVIGIASASVFLH
Sequence Length
241
Species
Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,262 Da
NCBI Official Full Name
hypothetical protein PGUG_04699
NCBI Official Symbol
PGUG_04699
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Protein ROT1
UniProt Gene Name
ROT1
UniProt Entry Name
ROT1_PICGU
Uniprot Description
Function: Required for normal levels of the cell wall 1,6-beta-glucan. Involved in a protein folding machinery chaperoning proteins acting in various physiological processes including cell wall synthesis and lysis of autophagic bodies
By similarity.
Subcellular location: Endoplasmic reticulum membrane; Single-pass type I membrane protein
By similarity.
Sequence similarities: Belongs to the ROT1 family.
Similar Products
Product Notes
The PGUG_04699 rot1 (Catalog #AAA1115763) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-241. The amino acid sequence is listed below: DPNMKELAGT WTSKSNTVFT GPGFYDPVDE LLIQPDLPGI SYSFTEDGHY EEALYRVTSN SQNHSCATAV LIYQHGTYEI LNNGSLVMTP IAVDGRQLLS DPCGYSETES QYTRYVQPTW FKAYYVQVDS YSGKMKLQIY QFDGSLMQPL YLAYSPPLML PTKALNPTDK ASETKSSLRR KVKRSLENQY RTTAVKSFNY EKYDKYWWAA VGVIGIASAS VFLH. It is sometimes possible for the material contained within the vial of "Protein ROT1 (ROT1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
