Fatty acid desaturase (des) Recombinant Protein | des recombinant protein
Recombinant Bacillus subtilis Fatty acid desaturase (des)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fatty acid desaturase (des); Recombinant Bacillus subtilis Fatty acid desaturase (des); Recombinant Fatty acid desaturase (des); Fatty acid desaturase EC= 1.14.19.-; Delta(5) acyl-lipid desaturase Delta(5) desaturase; des recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-352
Sequence
MTEQTIAHKQKQLTKQVAAFAQPETKNSLIQLLNTFIPFFGLWFLAYLSLDVSYLLTLALTVIAAGFLTRIFIIFHDCCHQSFFKQKRYNHILGFLTGVLTLFPYLQWQHSHSIHHATSSNLDKRGTGDIWMLTVNEYKAASRRTKLAYRLYRNPFIMFILGPIYVFLITNRFNKKGARRKERVNTYLTNLAIVALAAACCLIFGWQSFLLVQGPIFLISGSIGVWLFYVQHTFEDSYFEADENWSYVQAAVEGSSFYKLPKLLQWLTGNIGYHHVHHLSPKVPNYKLEVAHEHHEPLKNVPTITLKTSLQSLAFRLWDEDNKQFVSFRAIKHIPVSLPPDSPEKQKLRKNA
Sequence Length
352
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,708 Da
NCBI Official Full Name
fatty acid desaturase
NCBI Official Symbol
des
NCBI Protein Information
fatty acid desaturase
UniProt Protein Name
Fatty acid desaturase
Protein Family
UniProt Gene Name
des
UniProt Synonym Gene Names
desA; yocE
UniProt Entry Name
DES_BACSU
Uniprot Description
Function: Catalyzes the introduction of a cis-double bond at the delta5 position of existing saturated fatty acids attached to membrane phospholipids. It is not strictly specific for palmitic acid (C16) but can also accept C14 as well as C18 species to yield unsaturated fatty acids. Ref.2
Pathway: Lipid metabolism; fatty acid metabolism.
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Induction: Transcriptionally regulated by DesR/DesK in response to cold shock. Ref.2 Ref.4
Sequence similarities: Belongs to the fatty acid desaturase family.
Similar Products
Product Notes
The des des (Catalog #AAA1066756) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-352. The amino acid sequence is listed below: MTEQTIAHKQ KQLTKQVAAF AQPETKNSLI QLLNTFIPFF GLWFLAYLSL DVSYLLTLAL TVIAAGFLTR IFIIFHDCCH QSFFKQKRYN HILGFLTGVL TLFPYLQWQH SHSIHHATSS NLDKRGTGDI WMLTVNEYKA ASRRTKLAYR LYRNPFIMFI LGPIYVFLIT NRFNKKGARR KERVNTYLTN LAIVALAAAC CLIFGWQSFL LVQGPIFLIS GSIGVWLFYV QHTFEDSYFE ADENWSYVQA AVEGSSFYKL PKLLQWLTGN IGYHHVHHLS PKVPNYKLEV AHEHHEPLKN VPTITLKTSL QSLAFRLWDE DNKQFVSFRA IKHIPVSLPP DSPEKQKLRK NA. It is sometimes possible for the material contained within the vial of "Fatty acid desaturase (des), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
