Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Ectonucleoside triphosphate diphosphohydrolase 5 (ENTPD5) Recombinant Protein | ENTPD5 recombinant protein

Recombinant Bovine Ectonucleoside triphosphate diphosphohydrolase 5 (ENTPD5)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ectonucleoside triphosphate diphosphohydrolase 5 (ENTPD5); Recombinant Bovine Ectonucleoside triphosphate diphosphohydrolase 5 (ENTPD5); Recombinant Ectonucleoside triphosphate diphosphohydrolase 5 (ENTPD5); Ectonucleoside triphosphate diphosphohydrolase 5; NTPDase 5 EC= 3.6.1.6; Guanosine-diphosphatase ENTPD5; GDPase ENTPD5 EC= 3.6.1.42 Uridine-diphosphatase ENTPD5; UDPase ENTPD5; ENTPD5 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-432
Sequence
STVFHREQQTWFEGVFLSSMCPVNVSAGTLYGIMFDAGSTGTRIHVYTFVQKVPDNTGQLPVLEGEIFDSVKPGLSAFVDQPKQGAETVQELLEVAKDSIPPSHWKRTPVVLKATAGLRLLPEEKAEALLFEVKEIFKKSPFLVPDDSVSIMDGSYEGILAWVTVNFLTGQLHGHNQETVGTLDLGGASTQITFLPQFEKTLEQTPRDYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETAGIDGYTFRSACLPRWLEAEWIFGGVKYQYGGNQEAGEVGFEPCYAEVLRVVQGKLHQPDEVQRGSFYAFSYYYDRAVDTDMIDYEKGGVLKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFASSTVLQLTKKVNNIETGWALGATFHLLQSLGISH
Sequence Length
432
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
47,888 Da
UniProt Protein Name
Ectonucleoside triphosphate diphosphohydrolase 5
UniProt Gene Name
ENTPD5
UniProt Synonym Gene Names
NTPDase 5; GDPase ENTPD5; UDPase ENTPD5
UniProt Entry Name
ENTP5_BOVIN

Uniprot Description

Function: Uridine diphosphatase (UDPase) that promotes protein N-glycosylation and ATP level regulation. UDP hydrolysis promotes protein N-glycosylation and folding in the endoplasmic reticulum, as well as elevated ATP consumption in the cytosol via an ATP hydrolysis cycle. Together with CMPK1 and AK1, constitutes an ATP hydrolysis cycle that converts ATP to AMP and results in a compensatory increase in aerobic glycolysis. Also hydrolyzes GDP and IDP but not any other nucleoside di-, mono- or triphosphates, nor thiamine pyrophosphate. Plays a key role in the AKT1-PTEN signaling pathway by promoting glycolysis in proliferating cells in response to phosphoinositide 3-kinase (PI3K) signaling

By similarity.

Catalytic activity: GDP + H2O = GMP + phosphate.A nucleoside diphosphate + H2O = a nucleotide + phosphate.

Cofactor: Calcium

By similarity.Magnesium

By similarity.

Pathway: Protein modification; protein glycosylation.

Subcellular location: Endoplasmic reticulum membrane

By similarity; Single-pass type II membrane protein

By similarity.

Post-translational modification: N-glycosylated; high-mannose type

By similarity.

Sequence similarities: Belongs to the GDA1/CD39 NTPase family.

Similar Products

Product Notes

The Ectonucleoside triphosphate diphosphohydrolase 5 (ENTPD5) entpd5 (Catalog #AAA1058570) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-432. The amino acid sequence is listed below: STVFHREQQT WFEGVFLSSM CPVNVSAGTL YGIMFDAGST GTRIHVYTFV QKVPDNTGQL PVLEGEIFDS VKPGLSAFVD QPKQGAETVQ ELLEVAKDSI PPSHWKRTPV VLKATAGLRL LPEEKAEALL FEVKEIFKKS PFLVPDDSVS IMDGSYEGIL AWVTVNFLTG QLHGHNQETV GTLDLGGAST QITFLPQFEK TLEQTPRDYL TSFEMFNSTY KLYTHSYLGF GLKAARLATL GALETAGIDG YTFRSACLPR WLEAEWIFGG VKYQYGGNQE AGEVGFEPCY AEVLRVVQGK LHQPDEVQRG SFYAFSYYYD RAVDTDMIDY EKGGVLKVED FERKAREVCD NLENFTSGSP FLCMDLSYIT ALLKDGFGFA SSTVLQLTKK VNNIETGWAL GATFHLLQSL GISH. It is sometimes possible for the material contained within the vial of "Ectonucleoside triphosphate diphosphohydrolase 5 (ENTPD5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.