Dol-P-Man:Man (7)GlcNAc (2)-PP-Dol alpha-1,6-mannosyltransferase Recombinant Protein | ALG12 recombinant protein
Recombinant Arabidopsis thaliana Dol-P-Man:Man (7)GlcNAc (2)-PP-Dol alpha-1,6-mannosyltransferase, partial
Gene Names
ALG12; EBS4; EMS-MUTAGENIZED BRI1(BRASSINOSTEROID INSENSITIVE 1) SUPPRESSOR 4; homolog of asparagine-linked glycosylation 12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dol-P-Man:Man (7)GlcNAc (2)-PP-Dol alpha-1; 6-mannosyltransferase; Recombinant Arabidopsis thaliana Dol-P-Man:Man (7)GlcNAc (2)-PP-Dol alpha-1; partial; ALG12 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-497
Sequence
MPTDSKMAKFLQSYGYDLILGSVAAIYVVMAPYTKVEESFNVQSMHDILYHRHHLDSYDHLEFPGVVPRTFIGAFIVSVFASPVVSIISCLGFPKVYSLVAARLVLGCIILSTLRFFRIQIKKKFGNQVETFFVLFTSLQFHFLFYCTRPLPNILALGLVNLAYGNWLKGNFYPALSFLIFATVIFRCDTMLLLGPIGLELLLTKSISFWKALKYCVGTALLAVGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYPLSLLGTLVDRRVPFFIVPVLSFVILYSKLPHKELRFIISSVPMFNLSAAVAASRIYNNRKKTIWKLVNMVMLAFFAISAGCTVVTFMASYYNYPSGYALKRLHQIGHPANVAGEEWVHIDTFGAMNGISRFCEDDFPWRYSKEEEIVVEELRNRNFTYLVNEHSSVDGYKCLFYEEGFERLELRRGFPPIVLVKKAKVYLHREMKKEDPFHKKWPGC
Sequence Length
497
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,317 Da
NCBI Official Full Name
homolog of asparagine-linked glycosylation 12
NCBI Official Symbol
ALG12
NCBI Official Synonym Symbols
EBS4; EMS-MUTAGENIZED BRI1(BRASSINOSTEROID INSENSITIVE 1) SUPPRESSOR 4; homolog of asparagine-linked glycosylation 12
NCBI Protein Information
homolog of asparagine-linked glycosylation 12
UniProt Protein Name
Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
UniProt Gene Name
ALG12
UniProt Synonym Gene Names
EBS4
Uniprot Description
Required for N-linked oligosaccharide assembly. Adds the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor dolichol-PP-Man7GlcNAc2.
Research Articles on ALG12
Similar Products
Product Notes
The ALG12 alg12 (Catalog #AAA1032528) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-497. The amino acid sequence is listed below: MPTDSKMAKF LQSYGYDLIL GSVAAIYVVM APYTKVEESF NVQSMHDILY HRHHLDSYDH LEFPGVVPRT FIGAFIVSVF ASPVVSIISC LGFPKVYSLV AARLVLGCII LSTLRFFRIQ IKKKFGNQVE TFFVLFTSLQ FHFLFYCTRP LPNILALGLV NLAYGNWLKG NFYPALSFLI FATVIFRCDT MLLLGPIGLE LLLTKSISFW KALKYCVGTA LLAVGLTIFV DSIMWKKFVW PEFEVFWFNS ILNRSSDWGT HSIHWYFTSA LPRSLLVAYP LSLLGTLVDR RVPFFIVPVL SFVILYSKLP HKELRFIISS VPMFNLSAAV AASRIYNNRK KTIWKLVNMV MLAFFAISAG CTVVTFMASY YNYPSGYALK RLHQIGHPAN VAGEEWVHID TFGAMNGISR FCEDDFPWRY SKEEEIVVEE LRNRNFTYLV NEHSSVDGYK CLFYEEGFER LELRRGFPPI VLVKKAKVYL HREMKKEDPF HKKWPGC. It is sometimes possible for the material contained within the vial of "Dol-P-Man:Man (7)GlcNAc (2)-PP-Dol alpha-1,6-mannosyltransferase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
