Bidirectional sugar transporter N3 (N3) Recombinant Protein | N3 recombinant protein
Recombinant Medicago truncatula Bidirectional sugar transporter N3 (N3)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bidirectional sugar transporter N3 (N3); Recombinant Medicago truncatula Bidirectional sugar transporter N3 (N3); Recombinant Bidirectional sugar transporter N3 (N3); Bidirectional sugar transporter N3; Nodulin 3; MtN3; N-3; N3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-268
Sequence
MAISHNTLAFTFGMLGNVISFLVFLAPISTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYALLKKDAFLLITINSFGCVVETIYIILYIIYAPRDARNLTFKLLSAMNVGSFALILIVTNYAVHGPLRVQVLGWVCVSLSVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSATMWFGYGFFLKDICIXLPNVLGXVLGLLQMLLYAIYRNGGEKAMKKEKKAPIEPPKSIVIETQLEKIEQEKKNKDDDNEEKDKSEEPIGCGV
Sequence Length
268
Species
Medicago truncatula (Barrel medic) (Medicago tribuloides)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
30,084 Da
NCBI Official Full Name
Bidirectional sugar transporter N3
UniProt Protein Name
Bidirectional sugar transporter N3
Protein Family
UniProt Gene Name
N3
UniProt Synonym Gene Names
MtN3; N-3
UniProt Entry Name
NOD3_MEDTR
Uniprot Description
Function: Mediates both low-affinity uptake and efflux of sugar across the plasma membrane
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein
By similarity.
Developmental stage: Accumulates rapidly but transiently before nodule emergence and in the first days of nodulation. Later disappears in two-week-old nodules. Ref.1
Induction: During nodulation. Ref.1
Sequence similarities: Belongs to the SWEET sugar transporter family.Contains 2 MtN3/slv domains.
Similar Products
Product Notes
The Bidirectional sugar transporter N3 (N3) n3 (Catalog #AAA1009345) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-268. The amino acid sequence is listed below: MAISHNTLAF TFGMLGNVIS FLVFLAPIST FYRIYKKKST EGFQSLPYLV ALFSSMLWLY YALLKKDAFL LITINSFGCV VETIYIILYI IYAPRDARNL TFKLLSAMNV GSFALILIVT NYAVHGPLRV QVLGWVCVSL SVSVFAAPLS IVAQVVRTKS VEFMPFNLSF TLTLSATMWF GYGFFLKDIC IXLPNVLGXV LGLLQMLLYA IYRNGGEKAM KKEKKAPIEP PKSIVIETQL EKIEQEKKNK DDDNEEKDKS EEPIGCGV. It is sometimes possible for the material contained within the vial of "Bidirectional sugar transporter N3 (N3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
